A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10068
Swiss-prot Accession number	Q8JIM3 (Sequence in FASTA format)
Description	Growth hormone-releasing peptides precursor [Contains: Growth hormone-releasing peptide (GH-releasing peptide) (fGRP); fGRP-related peptide1; fGRP-related peptide 2; fGRP-related peptide 3].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the FARP (FMRFamide related peptide) family.
Tissue Specificity	Observed in the suprachiasmatic nucleus and in several telencephalic and diencephalic regions
Post translational modification	N/A
Function	Primary role is to release GH from the pituitary. May act as an endogenous ligand in the bullfrog hypothalamo-hypophysial system
Protein Length	221 Amino acids
Molecular weight	25886
References	1  PubMed abstract 12208659 2  PubMed abstract 11796493
Domain Name	N/A
Hormone Name	Growth hormone-releasing peptide
Mature Hormone Sequence	SLKPAANLPLRF
Position of mature hormone in Pre-Hormone protein	12 Residues from position (96-107)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10209
Swiss-prot Accession number	Q9PS36 (Sequence in FASTA format)
Description	Follitropin subunit beta (Follicle-stimulating hormone beta subunit)(FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	107 Amino acids
Molecular weight	11794
References	1  PubMed abstract 1426958 2  PubMed abstract 1426958
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELSNITIVLEKEECGACVSVNATWCSGYCYTKDANLMYPQKSEKQGVCTYTEVIYETVKIPGCAENVNPFYTYPVAVDCHCGRCDSETTDCTVRALGPTYCSLSQD
Position of mature hormone in Pre-Hormone protein	107 Residues from position (1-107)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10340
Swiss-prot Accession number	Q90Y63 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (LHRH I) (Luteinizing hormone-releasing hormone I) (Gonadotropin-releasing hormone I) (GnRH I)(Luliberin I); GnRH-associated peptide 1 (GnRH-associated peptide I)(GAP1)].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted protein
Developmental Stage	Expressed at significantly higher levels during post-breeding. Not expressed in pituitary.
Similarity	Belongs to the GnRH family.
Tissue Specificity	Forebrain
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	90 Amino acids
Molecular weight	10291
References	1  PubMed abstract 11170016
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSYGLRPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (25-34)
Receptor	Q9DE60   Detail in HMRbase    Q9DE62   Detail in HMRbase    Q9DE63    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 4

HMRbase accession number	10628
Swiss-prot Accession number	P80051 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain (Anterior pituitary glycoproteinhormones common subunit alpha) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain)(Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropin alphachain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	97 Amino acids
Molecular weight	11036
References	1  PubMed abstract 1730225 2  PubMed abstract 1701134
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDDNFLTPGCPECRLKENLRFSNMGIGRIYQCSGCCYSRAYPTPMRSKKTMLVPKNITSEAKCCVAKTQYRVTVMDNVKIENHTACHCSTCLYHKS
Position of mature hormone in Pre-Hormone protein	97 Residues from position (1-97)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10644
Swiss-prot Accession number	P80071 (Sequence in FASTA format)
Description	Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	112 Amino acids
Molecular weight	12676
References	1  PubMed abstract 1555571
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	RHVCHLANATISAEKDHCPVCITFTTSICTGYCQTMDPVYKTALSSFKQNICTYKEIRYDTIKLPDCLPGTDPFFTYPVALSCYCDLCKMDYSDCTVESSEPDVCMKRRISI
Position of mature hormone in Pre-Hormone protein	112 Residues from position (1-112)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10690
Swiss-prot Accession number	P15427 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4225
References	1  PubMed abstract 3260236
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APSEPHHPGDQATPDQLAQYYSDLYQYITFITRPRF
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10762
Swiss-prot Accession number	P10813 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted protein
Developmental Stage	Levels increase as metamorphosis progresses, reach maxima in juveniles and decrease as adulthood approaches.
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control
Protein Length	215 Amino acids
Molecular weight	24975
References	1  PubMed abstract 3260110 2  PubMed abstract 1476615 3  PubMed abstract 1859828
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	FPQMSLSNLFTNAVIRAQHLHQMVADTYRDYERTYIPEDQRFSNKHSYSVYCYSETIPAPTDKDNTHQKSDIDLLRFSLTLLQSWMTPIQIVNRVFGNNQVFGNIDRVYDRLRDLDEGLHILIRELDDGNVRNYGVLTFTYDKFDVNLRSEEGRAKNYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (26-215)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10951
Swiss-prot Accession number	P11885 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	263 Amino acids
Molecular weight	30389
References	1  PubMed abstract 2788269 2  PubMed abstract 1331997 3  PubMed abstract 2788269 4  PubMed abstract 1331997
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMSHFRWNKF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (77-87)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10952
Swiss-prot Accession number	P11885 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	263 Amino acids
Molecular weight	30389
References	1  PubMed abstract 2788269 2  PubMed abstract 1331997 3  PubMed abstract 2788269 4  PubMed abstract 1331997
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSESFPIEL
Position of mature hormone in Pre-Hormone protein	39 Residues from position (144-182)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10953
Swiss-prot Accession number	P11885 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	263 Amino acids
Molecular weight	30389
References	1  PubMed abstract 2788269 2  PubMed abstract 1331997 3  PubMed abstract 2788269 4  PubMed abstract 1331997
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (144-156)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10954
Swiss-prot Accession number	P11885 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	263 Amino acids
Molecular weight	30389
References	1  PubMed abstract 2788269 2  PubMed abstract 1331997 3  PubMed abstract 2788269 4  PubMed abstract 1331997
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELSLEFDYPDTNSEEELDNGELLEGPVKKGRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	79 Residues from position (185-263)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10955
Swiss-prot Accession number	P11885 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	263 Amino acids
Molecular weight	30389
References	1  PubMed abstract 2788269 2  PubMed abstract 1331997 3  PubMed abstract 2788269 4  PubMed abstract 1331997
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELSLEFDYPDTNSEEELDNGELLEGPVKKGRKYKMHHFRWEGPPKD
Position of mature hormone in Pre-Hormone protein	46 Residues from position (185-230)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10956
Swiss-prot Accession number	P11885 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	263 Amino acids
Molecular weight	30389
References	1  PubMed abstract 2788269 2  PubMed abstract 1331997 3  PubMed abstract 2788269 4  PubMed abstract 1331997
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	GRKYKMHHFRWEGPPKD
Position of mature hormone in Pre-Hormone protein	17 Residues from position (214-230)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10957
Swiss-prot Accession number	P11885 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	263 Amino acids
Molecular weight	30389
References	1  PubMed abstract 2788269 2  PubMed abstract 1331997 3  PubMed abstract 2788269 4  PubMed abstract 1331997
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (233-263)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	10958
Swiss-prot Accession number	P11885 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	263 Amino acids
Molecular weight	30389
References	1  PubMed abstract 2788269 2  PubMed abstract 1331997 3  PubMed abstract 2788269 4  PubMed abstract 1331997
Domain Name	NPP  ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (233-237)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	11119
Swiss-prot Accession number	P15438 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide 1; Glucagon-like peptide 2] (Fragments).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	103 Amino acids
Molecular weight	11721
References	1  PubMed abstract 3260236
Domain Name	Hormone_2
Hormone Name	Glucagon-36
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNSKRSGGIS
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	11120
Swiss-prot Accession number	P15438 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide 1; Glucagon-like peptide 2] (Fragments).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	103 Amino acids
Molecular weight	11721
References	1  PubMed abstract 3260236
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNS
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	11121
Swiss-prot Accession number	P15438 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide 1; Glucagon-like peptide 2] (Fragments).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	103 Amino acids
Molecular weight	11721
References	1  PubMed abstract 3260236
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 1
Mature Hormone Sequence	HADGTFTSDMSSYLEEKAAKEFVDWLIKGRPK
Position of mature hormone in Pre-Hormone protein	32 Residues from position (39-70)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	11122
Swiss-prot Accession number	P15438 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide 1; Glucagon-like peptide 2] (Fragments).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	103 Amino acids
Molecular weight	11721
References	1  PubMed abstract 3260236
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFTSDFNKALDIKAAQEFLDWIINTPVKE
Position of mature hormone in Pre-Hormone protein	33 Residues from position (71-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	11189
Swiss-prot Accession number	P80344 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 33 (CCK33); Cholecystokinin 8 (CCK8);Cholecystokinin 7 (CCK7)].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14449
References	1  PubMed abstract 9075736 2  PubMed abstract 7925386
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QQTVGSMNEDPGAREIEQQNILQHPRHIRASSSAQLKPFQRIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	110 Residues from position (21-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 21

HMRbase accession number	11190
Swiss-prot Accession number	P80344 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 33 (CCK33); Cholecystokinin 8 (CCK8);Cholecystokinin 7 (CCK7)].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14449
References	1  PubMed abstract 9075736 2  PubMed abstract 7925386
Domain Name	Gastrin
Hormone Name	Cholecystokinin-58
Mature Hormone Sequence	RIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	58 Residues from position (61-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 22

HMRbase accession number	11191
Swiss-prot Accession number	P80344 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 33 (CCK33); Cholecystokinin 8 (CCK8);Cholecystokinin 7 (CCK7)].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14449
References	1  PubMed abstract 9075736 2  PubMed abstract 7925386
Domain Name	Gastrin
Hormone Name	Cholecystokinin-33
Mature Hormone Sequence	GSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	33 Residues from position (86-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 23

HMRbase accession number	11192
Swiss-prot Accession number	P80344 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 33 (CCK33); Cholecystokinin 8 (CCK8);Cholecystokinin 7 (CCK7)].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14449
References	1  PubMed abstract 9075736 2  PubMed abstract 7925386
Domain Name	Gastrin
Hormone Name	Cholecystokinin-8
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (111-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 24

HMRbase accession number	11193
Swiss-prot Accession number	P80344 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 33 (CCK33); Cholecystokinin 8 (CCK8);Cholecystokinin 7 (CCK7)].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14449
References	1  PubMed abstract 9075736 2  PubMed abstract 7925386
Domain Name	Gastrin
Hormone Name	Cholecystokinin-7
Mature Hormone Sequence	YMGWMDF
Position of mature hormone in Pre-Hormone protein	7 Residues from position (112-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 25

HMRbase accession number	11398
Swiss-prot Accession number	P0C234 (Sequence in FASTA format)
Description	Calcitonin.
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3426
References	1  PubMed abstract 9245522
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSGLSTCALMKLSQDLHRFNSYPRTNVGAGTP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	Q7SX84    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 26

HMRbase accession number	11508
Swiss-prot Accession number	Q9DG36 (Sequence in FASTA format)
Description	Progonadoliberin-2 precursor (Progonadoliberin II) [Contains:Gonadoliberin-2 (Gonadoliberin II) (LHRH II) (Luteinizing hormone-releasing hormone II) (Gonadotropin-releasing hormone II) (GnRH II)(Luliberin II); GnRH-associated peptide 2 (GnRH-associated peptide II)(GAP2)].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted protein
Developmental Stage	Expressed at significantly higher levels during hibernation and post-breeding. Not expressed in pituitary.
Similarity	Belongs to the GnRH family.
Tissue Specificity	Midbrain and hindbrain
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	93 Amino acids
Molecular weight	10668
References	1  PubMed abstract 11170016
Domain Name	N/A
Hormone Name	Gonadoliberin-2
Mature Hormone Sequence	QHWSHGWYPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (25-34)
Receptor	Q9DE60   Detail in HMRbase    Q9DE62   Detail in HMRbase    Q9DE63    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments